PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g048329m
Common NameCISIN_1g048329mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 607aa    MW: 68380.2 Da    PI: 6.2127
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g048329mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS277.83.2e-852195911374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaal....klfsev 87 
                        lv+lLl++Ae v  +++e+a++lL+r + +a+ +++p+qR+++ f+ AL++r+ r +++ ++k       + ++ +++         + ++ 
  orange1.1g048329m 219 LVHLLLAAAEKVGYQQFERASRLLSRCEWTAAARANPVQRIVFNFAAALRERIDReTGNFTAKEELGGIGNGMTLIDHGLGInpvfLTCYQR 310
                        68*****************************************************2222222222222222233333322212222448999 PP

               GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                         P++++ +lt  qa+ e v +++++Hi+Df+i  G+QW +L+qaLa+R++ p   l++T+v+    g+kee+e tg+ La+fAe+l++pf+f
  orange1.1g048329m 311 LPFHQVVYLTGAQAMIENVGNASKIHILDFEIRCGVQWTSLMQALAEREQRPIqLLKLTAVAF---GNKEEVEVTGKSLASFAESLNLPFQF 399
                        9************************************************6655499*******...89************************ PP

               GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                        +v+ ++++ +++ + ++++++E+l+V + l+l ++ + + +le+    +L ++k+l+P ++vv+e ea+hns+sF++rf+e+l +ysa fd+
  orange1.1g048329m 400 SVVCVTNFLEIKEQLFEIRNDESLIVYCPLMLRKMISCPSCLEN----LLGVIKKLNPSLMVVIEVEANHNSPSFVNRFIETLFFYSAYFDA 487
                        ***9*******************************977777777....******************************************** PP

               GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                        le  l +++e+r+ +E+  ++  i+nvva+eg+er+ r+ ++  Wr+ ++++ + ++ ls++   qa+l+l++ + +   +++++ +sl+ g
  orange1.1g048329m 488 LEICLEKNTETRTAMEAI-FNSGICNVVAMEGTERTVRNVKMDVWRAFFSRFRMVEIGLSDQSLYQANLVLKQLAcGSSCTLDKNGKSLIVG 578
                        ****************99.********************************************************9999************* PP

               GRAS 362 WkdrpLvsvSaWr 374
                        Wk+ p+ s+S+W+
  orange1.1g048329m 579 WKGTPIHSLSVWK 591
                        ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.721193570IPR005202Transcription factor GRAS
PfamPF035141.1E-82219591IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MANILFSSTS SFDFSEIQGR YSDILEDYHK DEAGIEQNQK QNQMFSMDGL GEISPPLCSQ  60
LGAYQEENSA KKVPTLLEEQ RHLLQQNKSN DLLLNELHAN FVFQTSHSPE MPKLKDVQTS  120
HDQEIKPVKE PFALSSLELL SNYAGGFKKL KGNLSGSYTR NESNAGGSKK LSTEDILRVA  180
GARYVHFFDQ SYDDLSMVMH PFGYGLPGLS EEETRDVELV HLLLAAAEKV GYQQFERASR  240
LLSRCEWTAA ARANPVQRIV FNFAAALRER IDRETGNFTA KEELGGIGNG MTLIDHGLGI  300
NPVFLTCYQR LPFHQVVYLT GAQAMIENVG NASKIHILDF EIRCGVQWTS LMQALAEREQ  360
RPIQLLKLTA VAFGNKEEVE VTGKSLASFA ESLNLPFQFS VVCVTNFLEI KEQLFEIRND  420
ESLIVYCPLM LRKMISCPSC LENLLGVIKK LNPSLMVVIE VEANHNSPSF VNRFIETLFF  480
YSAYFDALEI CLEKNTETRT AMEAIFNSGI CNVVAMEGTE RTVRNVKMDV WRAFFSRFRM  540
VEIGLSDQSL YQANLVLKQL ACGSSCTLDK NGKSLIVGWK GTPIHSLSVW KFSRERGRPF  600
LNYKFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2925459138375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006492448.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLA0A067H5400.0A0A067H540_CITSI; Uncharacterized protein
STRINGPOPTR_0014s11510.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16533913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-52RGA-like 2